PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00069g00510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family NAC
Protein Properties Length: 236aa    MW: 26931 Da    PI: 7.577
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00069g00510.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.67.7e-4371392128
                       NAM   2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknratks 80 
                               +pGfrF Pt+eelv++yL++kv+g++  ++++vi+ v+iy+++Pw+Lp+       ++++++w+fF++ ++++a+g r++r t++
  Peaxi162Scf00069g00510.1   7 QPGFRFYPTEEELVNFYLRNKVDGRRdQHIQRVIPVVNIYHHNPWELPQmagegIREESSEQWFFFIPMQEREARGGRPTRLTTA 91 
                               79**********************996667778***************64555322235569*********************** PP

                       NAM  81 gyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               gyWkatg    v+s++++ +g k+t+vfy+grap+g+kt W m+eyr+
  Peaxi162Scf00069g00510.1  92 GYWKATGCPGYVYSSNNRIIGGKRTMVFYTGRAPHGKKTIWKMNEYRA 139
                               **********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-473168IPR003441NAC domain
PROSITE profilePS5100547.0896168IPR003441NAC domain
PfamPF023653.5E-218138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MEMYDVQPGF RFYPTEEELV NFYLRNKVDG RRDQHIQRVI PVVNIYHHNP WELPQMAGEG  60
IREESSEQWF FFIPMQEREA RGGRPTRLTT AGYWKATGCP GYVYSSNNRI IGGKRTMVFY  120
TGRAPHGKKT IWKMNEYRAT SDGEASLTNN ITNLKLRHEF SLCRVYKKSK CVRSFDRRPT  180
GFEGIPPQSI TGGDDQAASS NQNLPSVESS SSGGEHHDGT SQPGESVDCL NLWEDP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A7e-32116815168NAC domain-containing protein 19
3swm_B7e-32116815168NAC domain-containing protein 19
3swm_C7e-32116815168NAC domain-containing protein 19
3swm_D7e-32116815168NAC domain-containing protein 19
3swp_A7e-32116815168NAC domain-containing protein 19
3swp_B7e-32116815168NAC domain-containing protein 19
3swp_C7e-32116815168NAC domain-containing protein 19
3swp_D7e-32116815168NAC domain-containing protein 19
3ulx_A6e-32516914169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009620854.11e-120PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR39e-76NAC90_ARATH; NAC domain-containing protein 90
TrEMBLK4CR452e-95K4CR45_SOLLC; Uncharacterized protein
STRINGSolyc09g010160.1.15e-95(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.12e-72NAC domain containing protein 90